PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010923245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 456aa    MW: 49862.9 Da    PI: 6.839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010923245.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-17116162148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd  lv +vkq+G ++W+ Ia+++  gR++kqc++rw+++l
   XP_010923245.1 116 KGQWTVEEDGMLVGLVKQHGVRQWSQIAKKLV-GRSGKQCRERWHNHL 162
                      799*****************************.*************97 PP

2Myb_DNA-binding59.66.7e-19168210145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+eE+ llv+a+k+ G++ W+ Ia++++ gR+++++k++w+
   XP_010923245.1 168 KDTWTEEEERLLVEAHKKVGNR-WAEIAKHIP-GRSENSIKNHWN 210
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.524111162IPR017930Myb domain
SuperFamilySSF466892.95E-31115209IPR009057Homeodomain-like
SMARTSM007173.8E-15115164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-27117169IPR009057Homeodomain-like
PfamPF139212.0E-18119179No hitNo description
CDDcd001679.62E-15119162No hitNo description
PROSITE profilePS5129428.616163217IPR017930Myb domain
SMARTSM007178.3E-18167215IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-21170215IPR009057Homeodomain-like
CDDcd001672.08E-15170210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MDFNMETVSA GRIDGLVEKS ARSFRPAPPL TPLQRFLASS CHGELRLVKS PIGKLEQKAE  60
IPPGAIGVPP DGMLLNDFSF YDDAKNAIIR SKNCGEGNGV KGSSSTTVAA ASAVVKGQWT  120
VEEDGMLVGL VKQHGVRQWS QIAKKLVGRS GKQCRERWHN HLRPDIKKDT WTEEEERLLV  180
EAHKKVGNRW AEIAKHIPGR SENSIKNHWN ATRRRQSAKR RSKRKTAVQG GRSRPSILHE  240
YVRSKMLELR DNCTTKFAPS AAPPSPPHQH HITFPNVQEP SSALDSSIST ATQMEDPTAS  300
FMEAFFLDRS ATGSAEEGEF HVGDVQEPCK LDPLDVLDLD DGDYLMGGVD ECISLAPPPA  360
LDMFHSEANG LSTAVSDGTI ITKSAAPLFS DNYISYLLNG APSSSADVFG SANTEILEDQ  420
TSSSCKRELD LIEMLSLQSS RSRSLTQTSS SSNTSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-451142165107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923245.10.0PREDICTED: uncharacterized protein LOC105046375
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.12e-51myb domain protein 119